DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Cela1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:255 Identity:74/255 - (29%)
Similarity:118/255 - (46%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TDSYAVGQSKYGRIEKFPYQVML--IGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLG 87
            |::..||.:: .|...:|.|:.|  :....|..  .|||||:.:.|::||.||......:.|.:|
  Rat    23 TNARVVGGAE-ARRNSWPSQISLQYLSGGSWYH--TCGGTLIRRNWVMTAAHCVSSQMTFRVVVG 84

  Fly    88 TKSVEDTEVSGGLVLRSNKFIVHERFNPE--TAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQ 150
            ..::...:.:...| ...|.:||..:|..  .|..||||::|.|.|.....:|.|.||..     
  Rat    85 DHNLSQNDGTEQYV-SVQKIVVHPNWNSNNVAAGYDIALLRLAQSVTLNNYVQLAVLPQE----- 143

  Fly   151 FAGMSVVA-------SGWGAMVEMTN---SDSMQYTELKVISNAECAQEY---DVVTSGVICAKG 202
               .:::|       :|||.  ..||   |.::|...|..:..:.|:...   ..|.:.::||.|
  Rat   144 ---GTILANNNPCYITGWGR--TRTNGQLSQTLQQAYLPSVDYSICSSSSYWGSTVKTTMVCAGG 203

  Fly   203 LKDETVCTGDSGGPL--VLKDTQIVVGITSFGPADGCE-TNIPGGFTRVTHYLDWIESKI 259
            ....:.|.|||||||  ::.....|.|:|||..:.||. :..|..||||:.|:.|:.:.|
  Rat   204 DGVRSGCQGDSGGPLHCLVNGQYSVHGVTSFVSSMGCNVSRKPTVFTRVSAYISWMNNVI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 70/240 (29%)
Tryp_SPc 37..255 CDD:214473 69/237 (29%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 71/245 (29%)
Tryp_SPc 27..262 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.