DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Ctrb1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:221 Identity:66/221 - (29%)
Similarity:111/221 - (50%) Gaps:13/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSN 105
            :|:||.|..|..:.   .|||:|:.:.|::||.||  ||...||.:..:..:.::.....||:..
  Rat    45 WPWQVSLQDKTGFH---FCGGSLISEDWVVTAAHC--GVKTSDVVVAGEFDQGSDEENIQVLKIA 104

  Fly   106 KFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVA-SGWGAMV--EM 167
            :...:.:||..|..|||.|:||.....|:..:....||:  ..|.|...:|.| :|||...  .:
  Rat   105 QVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPN--VDDDFPPGTVCATTGWGKTKYNAL 167

  Fly   168 TNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQI--VVGITS 230
            ...:.:|...|.::|.|:|.:.:....:.|:...|....:.|.||||||||.:...:  :.||.|
  Rat   168 KTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVS 232

  Fly   231 FGPADGCETNIPGGFTRVTHYLDWIE 256
            :| :..|.|:.|..::|||..:.|::
  Rat   233 WG-SGVCSTSTPAVYSRVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 66/221 (30%)
Tryp_SPc 37..255 CDD:214473 65/218 (30%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 65/218 (30%)
Tryp_SPc 34..259 CDD:238113 66/221 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.