DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Cela3a

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:275 Identity:85/275 - (30%)
Similarity:117/275 - (42%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVY 85
            :|:...|..|...:......:|:||.|..:........|||:|:...|:||||||.|...:|.|.
Mouse    19 QPSHNPSSRVVNGEEAVPHSWPWQVSLQYEMGGSFHHTCGGSLITPDWVLTAGHCIMPYLNYRVV 83

  Fly    86 LGTKSVEDTEVSGGLV-LRSNKFIVHERFNPE--TAANDIALVKLPQDVAFTPRIQPASLPSRYR 147
            ||.......|.|..:: :.:.:..||.::|.|  ...|:||||||.:.......:|.|.||.   
Mouse    84 LGEHEHGVEEGSEQVIPINAGELFVHPKWNSECVNCGNNIALVKLSRSAQLGDAVQLACLPP--- 145

  Fly   148 HDQFA------GMSVVASGWGAMVEMTNS---DSMQYTELKVISNAECAQEYD----------VV 193
                |      |.....||||.:  .||.   ..:|...|.|:....|:: :|          |.
Mouse   146 ----AGEILPNGAPCYISGWGRL--STNGPLPTKLQQALLPVVDYEHCSR-WDWWGHYVKRTMVC 203

  Fly   194 TSGVICAKGLKDET-------VCTGDSGGPL---VLKDTQIVVGITSFGPADGCET-NIPGGFTR 247
            ..|.|.|..|..:|       ...|||||||   ....|..|.||.||....||.| ..|..|||
Mouse   204 AGGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQVHGIASFVSPSGCNTLKKPTMFTR 268

  Fly   248 VTHYLDWIESKIGSH 262
            |:.::||||..|.::
Mouse   269 VSAFIDWIEETIANN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 81/253 (32%)
Tryp_SPc 37..255 CDD:214473 78/250 (31%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 79/258 (31%)
Tryp_SPc 28..279 CDD:238113 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.