DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Klk7

DIOPT Version :10

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:47 Identity:9/47 - (19%)
Similarity:23/47 - (48%) Gaps:3/47 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ECATVFKLLTGKDKPLLIRRDSFLILDLSLNIVNSIRTF---NLQSD 56
            |.|..|:......:.||:.::..|:..:::.:..:::.|   |:..|
Mouse   843 EIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIFARINMLKD 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 3/23 (13%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473
Serine protease. /evidence=ECO:0000250 26..246
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.