DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and TPSD1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:232 Identity:68/232 - (29%)
Similarity:102/232 - (43%) Gaps:26/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMMW-KPTPTDSY----AVGQSKYGRIEKFPYQVML-IGKQLWRKRILCGGTLLDKR 67
            ||.|.|:....: .|.|..:.    .||..:..| .|:|:||.| :....|..  .|||:|:..:
Human    13 LLALPVLASPAYVAPAPGQALQQTGIVGGQEAPR-SKWPWQVSLRVRGPYWMH--FCGGSLIHPQ 74

  Fly    68 WILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVA 132
            |:|||.||..........|..:..|........:|..::.|||.:|.......||||::|.:.|.
Human    75 WVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVN 139

  Fly   133 FTPRIQPASLPSRYRHDQF-AGMSVVASGWGAM---VEMTNSDSMQYTELKVISNAECAQEY--- 190
            .:..|...:||.  ..:.| .||....:|||.:   |.:.....::..|:.|:.|..|..||   
Human   140 ISSHIHTVTLPP--ASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTG 202

  Fly   191 -------DVVTSGVICAKGLKDETVCTGDSGGPLVLK 220
                   .:|...::|| |.::...|.||||||||.|
Human   203 LHTGHSFQIVRDDMLCA-GSENHDSCQGDSGGPLVCK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 60/199 (30%)
Tryp_SPc 37..255 CDD:214473 60/199 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 62/207 (30%)
Tryp_SPc 38..240 CDD:214473 62/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.