DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Prss8

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:281 Identity:81/281 - (28%)
Similarity:129/281 - (45%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHC---TMGVTHYDVYLGTKSVE 92
            |.:|.|   ::|:||.:    .:....:|||:|:..:|:::|.||   ......|:|.||...::
  Rat    49 GSAKPG---QWPWQVSI----TYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLD 106

  Fly    93 DTEVSGGLVLRS-NKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFA-GMS 155
              ..|..:|:.: .:.|.|..:..|.:..||||::|...|.|:..|:|..||:  .:..|. |:.
  Rat   107 --SFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPA--ANASFPNGLH 167

  Fly   156 VVASGWGAM---VEMTNSDSMQYTELKVISNAECAQEYDV---------VTSGVICA---KGLKD 205
            ...:|||.:   |.:.....:|..|:.:||...|:..|::         :...::||   ||.||
  Rat   168 CTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKD 232

  Fly   206 ETVCTGDSGGPL--VLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHGQVHQQ 268
              .|.|||||||  .:.....:.||.|:|.|.|. .|.||.:|..:.|..||      |..|.:.
  Rat   233 --ACQGDSGGPLSCPIDGLWYLAGIVSWGDACGA-PNRPGVYTLTSTYASWI------HHHVAEL 288

  Fly   269 YLR--PQQQH--------HHH 279
            ..|  ||.|.        :||
  Rat   289 QPRAVPQTQESQPDGHLCNHH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 70/242 (29%)
Tryp_SPc 37..255 CDD:214473 68/239 (28%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 71/245 (29%)
Tryp_SPc 45..284 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.