DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and try-5

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:292 Identity:64/292 - (21%)
Similarity:107/292 - (36%) Gaps:89/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PYQVMLIGKQLWRK---RILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSV--EDTEVSGGLV 101
            |:.|.:..|.  ||   .::|||||:..:.:|||.||      :..:.|.|..  |:..:||...
 Worm    55 PWAVQIRVKA--RKGDFEVICGGTLITLKHVLTAAHC------FQKHFGAKKEGGEENSMSGRYC 111

  Fly   102 LRSNKF-------------------------IVHERFNPET-----------------AANDIAL 124
            ..:.:|                         .|:|:.|.:|                 ..|||.:
 Worm   112 ESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVI 176

  Fly   125 VKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEMTNSD-----------SMQYTEL 178
            ::|...:........|.||.....:..:|.:|.:.|||       ||           .:|...|
 Worm   177 LELESTIDDVEGANYACLPFLPEVNIQSGANVTSFGWG-------SDPGKGFDNAAFPMIQVLTL 234

  Fly   179 KVISNAECAQEYDV-VTSGVICAKGLKDETVCTGDSGGPLVLKDT----QIVVGITSFGPADGCE 238
            ...:.|.|.:.:.. :.....|....:|:.||:|||||.|....:    :.::.|.|:|  ..|.
 Worm   235 ATETLATCEENWGTSIPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYG--SDCV 297

  Fly   239 TNIPGGFTRVTHYLDWIESKIGSHGQVHQQYL 270
            ..|.|...|         |:|.:..:.||:::
 Worm   298 QLIGGSEPR---------SQINTDVRKHQKFI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 60/278 (22%)
Tryp_SPc 37..255 CDD:214473 60/275 (22%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 56/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.