DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and try-3

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:236 Identity:71/236 - (30%)
Similarity:117/236 - (49%) Gaps:48/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKS---VEDTEVSGGLVLRSNKFIVHERFNPETA 118
            ||||.|::|..|::||.||.:       .|.|:|   |.:.:.:........:..:|..:|.:||
 Worm    64 ILCGATVIDDFWLVTAAHCAL-------QLQTRSFVYVREPKNNRERSFSVKEAYIHSGYNNQTA 121

  Fly   119 ANDIALVKLPQDVAFTPRIQPASLPSRYRHD------QFAGMSVVASGWGAMV--------EMTN 169
            .|||||:::..|:: ...|:|..|.    ||      |:....|:  |:|..:        ::.|
 Worm   122 DNDIALLRISSDLS-KLGIKPVCLV----HDDSKLLKQYKNGVVI--GYGLTLGEDSSGEPKLIN 179

  Fly   170 SDSMQYTELKVISNAECAQEYDV-------VTSGVICAKGLKDETVCTGDSGGPLVLKDTQ---I 224
            |.::|.|.:.:||:.:|.:.:..       :|...||| |........|||||||::..:.   :
 Worm   180 SQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICA-GAYLHGTAPGDSGGPLLIHKSNGEYV 243

  Fly   225 VVGITSFGPADGCETNI-----PGGFTRVTHYLDWIESKIG 260
            .:||||:| |||.:..|     ||.:||::.|:.||:..||
 Worm   244 QIGITSYG-ADGLDGVIDQGKFPGVYTRISKYVPWIQGVIG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/232 (30%)
Tryp_SPc 37..255 CDD:214473 67/229 (29%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.