DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and try-10

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:251 Identity:66/251 - (26%)
Similarity:103/251 - (41%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LCGGTLLDKRWILTAGHC---------TMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERF 113
            :|||.|:....::|:.||         |..||..||:|......:.|.....:..|.||     |
 Worm   103 VCGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKF-----F 162

  Fly   114 NPETAAN-DIALVKLPQ--DVAFTP-RIQPASLPS----RYRHD------QFAGMSVVASGWGAM 164
            |..:.|| |:|::.|||  ||..:| .:|.|.|||    .::..      |........:|||..
 Worm   163 NDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGWGKT 227

  Fly   165 VEMT--NSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDET-VCTGDSGGPL--VLKDTQI 224
            ...|  .|||::...:.:.......::|       :.||.:...: .|.||||.|:  .:...:|
 Worm   228 ENKTAKYSDSVRQMMVNLSVRRIGKRKY-------LIAKAVTGSSRACMGDSGSPVYCFVNGKRI 285

  Fly   225 VVG----ITSFGPADGCETNIPGGFTRVTHYL---DWIESK------IGSHGQVHQ 267
            :||    |.||......:.:....|.|...|.   ||.||.      :..:|:::|
 Worm   286 LVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDWRESSERVVEILQKYGELYQ 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 63/234 (27%)
Tryp_SPc 37..255 CDD:214473 61/231 (26%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 54/198 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.