DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Tpsb2

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:291 Identity:83/291 - (28%)
Similarity:134/291 - (46%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IMLMMW-----------KPTPTDSYA--VGQSKYGRIEKFPYQVMLIGK-QLWRKRILCGGTLLD 65
            ::|::|           .|.|.:...  ||..:... .|:|:||.|..| ..|..  .|||:|:.
Mouse     5 LLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASE-SKWPWQVSLRFKLNYWIH--FCGGSLIH 66

  Fly    66 KRWILTAGHCT---------MGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAAND 121
            .:|:|||.||.         ..|...:.||         ..|..:|..|:.:||..:.......|
Mouse    67 PQWVLTAAHCVGPHIKSPQLFRVQLREQYL---------YYGDQLLSLNRIVVHPHYYTAEGGAD 122

  Fly   122 IALVKLPQDVAFTPRIQPASLPSRYRHDQF-AGMSVVASGWGAMVEMTNSD------SMQYTELK 179
            :||::|...|..:..:.|.|||.  ..:.| .|.|...:|||   ::.|.:      .::..::.
Mouse   123 VALLELEVPVNVSTHLHPISLPP--ASETFPPGTSCWVTGWG---DIDNDEPLPPPYPLKQVKVP 182

  Fly   180 VISNAECAQEY----------DVVTSGVICAKGLKDETVCTGDSGGPLV--LKDTQIVVGITSFG 232
            ::.|:.|.::|          .:|..|::||...:.:: |.||||||||  :|.|.:..|:.|:|
Mouse   183 IVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDS-CQGDSGGPLVCKVKGTWLQAGVVSWG 246

  Fly   233 PADGC-ETNIPGGFTRVTHYLDWIESKIGSH 262
              :|| :.|.||.:||||:|||||...:..|
Mouse   247 --EGCAQPNKPGIYTRVTYYLDWIHRYVPEH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 76/250 (30%)
Tryp_SPc 37..255 CDD:214473 74/247 (30%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.