DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CTRL

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:270 Identity:78/270 - (28%)
Similarity:129/270 - (47%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMM---W-------KPTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTL 63
            ||.|.:.::::   |       ||..:.|..:...:...:..:|:||.|.....:.   .|||:|
Human     3 LLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFH---FCGGSL 64

  Fly    64 LDKRWILTAGHCTMGVTHYDVYLG----TKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIAL 124
            :.:.|::||.||.:....:.|.||    :.:.|..:     ||..::.|.|..:|..|..||:.|
Human    65 ISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQ-----VLSVSRAITHPSWNSTTMNNDVTL 124

  Fly   125 VKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEMTN--SDSMQYTELKVISNAECA 187
            :||.....:|.||.|..|.|. ......|::.|.:|||.:..:.|  ...:|...|.:::..:|.
Human   125 LKLASPAQYTTRISPVCLASS-NEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCR 188

  Fly   188 QEY-DVVTSGVICAKGLKDETVCTGDSGGPLVLK--DTQIVVGITSFGPADGCETNIPGGFTRVT 249
            |.: ..:|..:|||.| ...:.|.||||||||.:  :|.:::||.|:| ...|....|..:|||:
Human   189 QYWGSSITDSMICAGG-AGASSCQGDSGGPLVCQKGNTWVLIGIVSWG-TKNCNVRAPAVYTRVS 251

  Fly   250 HYLDWIESKI 259
            .:..||...|
Human   252 KFSTWINQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 70/229 (31%)
Tryp_SPc 37..255 CDD:214473 68/226 (30%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.