DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG43742

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:213 Identity:68/213 - (31%)
Similarity:101/213 - (47%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSN-KFIVHERFNPETAANDI 122
            |||:|:.|:::|||.||...:....|:||..:..........|||.| |.|:|..|:.....|||
  Fly    58 CGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDI 122

  Fly   123 ALVKLPQDVAFTPRIQPASL-----PSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVIS 182
            ||::|.::|.|...|:|..:     .:....:.|     .|.|||.......||.:.:.:|..:.
  Fly   123 ALLRLEREVIFEAHIRPICIILDEDVTSNNQNNF-----TAYGWGKTEHGNISDVLSFIDLVRLP 182

  Fly   183 NAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLV------LKDTQIVVGITSFGPADGCETNI 241
            .:.|.|..:     .|||.....:| |..||||||:      .|...|:.||||:|.|: | :.:
  Fly   183 KSMCYQNIN-----TICAGSTSGDT-CESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-C-SGL 239

  Fly   242 PGGFTRVTHYLDWIESKI 259
            .|.:|.|..|..||.|.:
  Fly   240 FGVYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 67/210 (32%)
Tryp_SPc 37..255 CDD:214473 65/207 (31%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 65/207 (31%)
Tryp_SPc 35..256 CDD:238113 67/210 (32%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.