DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Cela2a

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:235 Identity:83/235 - (35%)
Similarity:118/235 - (50%) Gaps:28/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVML--IGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLR 103
            :|:||.|  :....||..  |||:|:...|:|||.||......|.|.||..|:.:.. :|...::
Mouse    42 WPWQVSLQVLSSGRWRHN--CGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPG-AGSAAVQ 103

  Fly   104 SNKFIVHERFNPETAAN--DIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSV------VASG 160
            .:|.:||:|:|.:...|  ||||:||...|..:..||.|.||.       ||..:      ..:|
Mouse   104 VSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPP-------AGTILPRNYVCYVTG 161

  Fly   161 WGAMVEMTNS-DSMQYTELKVISNAECAQEY---DVVTSGVICAKGLKDETVCTGDSGGPLVLKD 221
            ||.:....|| |:::...|.|:..|.|:...   ..|.|.::||.|....:.|.|||||||..:.
Mouse   162 WGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRA 226

  Fly   222 TQ---IVVGITSFGPADGCE-TNIPGGFTRVTHYLDWIES 257
            :.   .|.||.|||.:.||. ...|..||||::|:|||.|
Mouse   227 SNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 83/235 (35%)
Tryp_SPc 37..255 CDD:214473 80/231 (35%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 80/231 (35%)
Tryp_SPc 31..267 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.