DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG43335

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:225 Identity:74/225 - (32%)
Similarity:108/225 - (48%) Gaps:33/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGTLLDKRWILTAGHCTMGVTHYDVYLG----TKS--------VEDTEVSGGLVLRSNKFIVHE 111
            |.|||:..:::|||.||.....:..|.||    |:|        .||..||        ..|.|:
  Fly    67 CAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVS--------MAIKHK 123

  Fly   112 RFNPETAANDIALVKLPQDVAFTPRIQPAS--LPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQ 174
            .|.|....||||:::|.:.|.|...|:|..  |....|.....||:::|:|||...:..:...:|
  Fly   124 YFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQ 188

  Fly   175 YTELKVISNAECAQEYDV-VTSGVICAKGLKDETVCTGDSGGPL-----VLKDTQIV-VGITSFG 232
            ...:.|::...|::.||| :|.|.||| |.|:...|.|||||||     ...|.:.| .||||||
  Fly   189 EAPITVMNRNVCSKLYDVAITQGQICA-GDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFG 252

  Fly   233 PADGCETNIPGGFTRVTHYLDWIESKIGSH 262
            ..: |.:  |..:|.::.|..||...:..:
  Fly   253 DIE-CRS--PSIYTDLSTYSGWINMVVSQY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 74/219 (34%)
Tryp_SPc 37..255 CDD:214473 72/216 (33%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 72/216 (33%)
Tryp_SPc 42..275 CDD:238113 74/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.