DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG43124

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:214 Identity:41/214 - (19%)
Similarity:75/214 - (35%) Gaps:51/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RILCGGTLLDKRWILTAGHCTMGVTHYDVYLGT----KSVEDTEVSGGLVLRSNKFIVHERFNPE 116
            :::|.|.|::..::|||..|........|.||:    ||.|:..|:     ::..::.|   .|.
  Fly    51 KVICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVT-----KAYFWMTH---FPA 107

  Fly   117 TAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVI 181
            ...|::.:.:|..:|.|...|:|..:..          |..:.|.....|:.|.....:...|.|
  Fly   108 NNTNNLCIFRLQTEVEFKTHIRPMCITK----------SPKSLGLATTFEIINEKPKMWYFCKNI 162

  Fly   182 SNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGC--------- 237
            ....|...:           |..:|...:..:|.|.    |:.:    |.||..|.         
  Fly   163 KGLFCKYVF-----------GENEEKWQSKPTGSPW----TETI----SNGPFKGLVRYGILSYR 208

  Fly   238 -ETNIPGGFTRVTHYLDWI 255
             .......:..|..:::||
  Fly   209 DNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 41/214 (19%)
Tryp_SPc 37..255 CDD:214473 39/212 (18%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.