DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and PRSS21

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:261 Identity:74/261 - (28%)
Similarity:119/261 - (45%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLV--- 101
            ::|:|..|   :||...: ||.:||..||.|||.||      ::.|     .:.::.||.:|   
Human    52 RWPWQGSL---RLWDSHV-CGVSLLSHRWALTAAHC------FETY-----SDLSDPSGWMVQFG 101

  Fly   102 -------------LRSNKFIVHERFNPETAAN---DIALVKLPQDVAFTPRIQPASL-PSRYRHD 149
                         ..:..|:.:...:|....|   |||||||...|.:|..|||..| .|.:..:
Human   102 QLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFE 166

  Fly   150 QFAGMSVVASGWGAMVE---MTNSDSMQYTELKVISNAECAQEY-----------DVVTSGVICA 200
            ......|  :|||.:.|   :.:..::|..::.:|:|:.|...:           |:|.:|  .|
Human   167 NRTDCWV--TGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAG--NA 227

  Fly   201 KGLKDETVCTGDSGGPLVLKDTQI--VVGITSFGPADGC-ETNIPGGFTRVTHYLDWIESKIGSH 262
            :|.||  .|.|||||||......:  .:|:.|:|.  || ..|.||.:|.::|:.:||:..:...
Human   228 QGGKD--ACFGDSGGPLACNKNGLWYQIGVVSWGV--GCGRPNRPGVYTNISHHFEWIQKLMAQS 288

  Fly   263 G 263
            |
Human   289 G 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/254 (29%)
Tryp_SPc 37..255 CDD:214473 71/251 (28%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.