DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and LOC100491119

DIOPT Version :10

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_004916446.1 Gene:LOC100491119 / 100491119 XenbaseID:XB-GENE-29080535 Length:512 Species:Xenopus tropicalis


Alignment Length:67 Identity:21/67 - (31%)
Similarity:28/67 - (41%) Gaps:12/67 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SECATVFKLL-TGKDKPLLIRRDSFLILDLSLNIVNSIRTFNLQSDD-DLTSCAVTK-TLNVGLS 73
            ||.::|..|. .|.....|.|...||||...::.:         :|: ||||....| ||...|.
 Frog    63 SELSSVVLLAGVGVQMDRLRRASDFLILPGFIDFI---------ADEVDLTSALTRKITLKTPLI 118

  Fly    74 KS 75
            .|
 Frog   119 SS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 12/41 (29%)
LOC100491119XP_004916446.1 SRCR_2 172..269 CDD:470597
Tryp_SPc 275..501 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.