DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:240 Identity:69/240 - (28%)
Similarity:112/240 - (46%) Gaps:45/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAG--HCTMGVTHYDVYLGTKSVEDT---EVSGGL 100
            :|:|..:..|.  .:...|||:|::|.|:||..  ...|..:...||||.::...:   |:|..:
Zfish    47 WPWQASINLKA--TEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNGSNPYEISRTV 109

  Fly   101 VLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVV------AS 159
                .|.|.|..:|  :..:::||:||...|.|:..|:|..|.:       ||...|      .:
Zfish   110 ----TKIIKHPNYN--SLDSNLALLKLSSPVTFSDYIKPVCLAA-------AGSVFVDGTASWVT 161

  Fly   160 GWG------AMVEMTNSDSMQYTELKVISNAECAQEY-DVVTSGVICAKGLKDE--TVCTGDSGG 215
            |||      .:.|:...|.:|..|..:::|.||...| .::|:.::||..|.::  ..|.||.||
Zfish   162 GWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGG 226

  Fly   216 PLVLKDTQIVV--GITSFGPADGCETNIPGG---FTRVTHYLDWI 255
            |||:|...|.:  |:...|     ...:||.   :.||:.|.|||
Zfish   227 PLVIKQGAIWIQSGVVVSG-----YCGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/240 (29%)
Tryp_SPc 37..255 CDD:214473 67/238 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 67/238 (28%)
Tryp_SPc 36..267 CDD:238113 69/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.