DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and LOC100004427

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:239 Identity:70/239 - (29%)
Similarity:102/239 - (42%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDV--YLGTKSVEDTEVSGGLVLR 103
            :|:|..:..|.  ..:..|.|:|:.:||:|||..|...:...||  |||..:...          
Zfish    47 WPWQASINFKS--TGQFFCSGSLISERWVLTAASCFQRINVSDVVIYLGRLTTNG---------- 99

  Fly   104 SNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVV------ASGWG 162
            ||.:.:.......:...|||||:|...|.||..|:|..|.:       ||...|      .:|||
Zfish   100 SNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCLAA-------AGSVFVDGTESWVTGWG 157

  Fly   163 AMVEMTN---SDSMQYTELKVISNAECAQEYDVVT-SGVICAKGLKDET---VCTGDSGGPLVLK 220
            : ...||   ||.::..|..:::|.||:....:.. ..|||| |..:||   .|..|.|.|||.:
Zfish   158 S-TSSTNVILSDMLKEVEAPIVNNIECSNINGITNLDNVICA-GFVNETGKAPCWEDFGSPLVTR 220

  Fly   221 DTQ--IVVGITSFGPADGCETN-IPGGFTRVTHYLDWIESKIGS 261
            ...  |..|:..|   ..|..| .|..:.||:.|.:||.:...|
Zfish   221 QGSQWIQSGVVVF---TFCGQNGFPTLYARVSEYEEWIRNYTSS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/234 (29%)
Tryp_SPc 37..255 CDD:214473 67/231 (29%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 67/231 (29%)
Tryp_SPc 36..257 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.