DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thoc6 and DWA1

DIOPT Version :9

Sequence 1:NP_001261750.1 Gene:thoc6 / 39394 FlyBaseID:FBgn0036263 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_849989.1 Gene:DWA1 / 816462 AraportID:AT2G19430 Length:367 Species:Arabidopsis thaliana


Alignment Length:336 Identity:85/336 - (25%)
Similarity:152/336 - (45%) Gaps:72/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNVLAQAISGSKQYLFAGNLFG-----DIFVLRIKELDKGSEEPPGKLKIFPQGSDVDINYLAFH 70
            |::::|:.|           ||     |:.|...:.:.:..|.|...:|.:  |.|.|...|:  
plant    60 NSLVSQSAS-----------FGYSKGQDVMVAEPERVVRAHEGPAYDVKFY--GEDEDALLLS-- 109

  Fly    71 RDFLIVGAVGLIYGLEWNEEEESLAT-------------------KRSWEVKIPMQVDAVEVPDV 116
                 .|..|.:.|.:|.|..||..:                   |..|....||       |::
plant   110 -----CGDDGRVRGWKWREFAESDVSLHLKENHLKPLLELINPQHKGPWGALSPM-------PEI 162

  Fly   117 NSMWLDSENSILFAGCGDGVIYQVSLEDGRIQREYRGHTDYVHSVVGNAN-GQIFSGAEDGTVRV 180
            |:|.:|.::..:|...||...|...:|.|:|:..::||:||:|:||..:: .||.:|:||||.|:
plant   163 NAMSVDPQSGSVFTAAGDSCAYCWDVESGKIKMTFKGHSDYLHTVVSRSSASQILTGSEDGTARI 227

  Fly   181 WSTKQQQHTSMLEPYKNPNLLRPDWGKWIGAVAV--NEDWLLCGGGPKASIFHLRSMESTCVFSF 243
            |..|..:...::......:.||      :.::|:  :|.||:||.|...::::|.:.|  ||.:.
plant   228 WDCKTGKCVKVIGSQDKKSRLR------VSSMALDGSESWLVCGQGKNLALWNLPASE--CVQTI 284

  Fly   244 PGRVHLCD--FVDDCVLIGGEHNHVQSYTLNGVLQANIPVEHTA-CYSAVWQTS--PIKFISIAG 303
            |...|:.|  |.:..:|..|....::.:.|||.|.:.|   |.| |  :|:..|  |...:::.|
plant   285 PIPAHVQDVMFDEKQILTVGAEPLLRRFDLNGALLSQI---HCAPC--SVFSISLHPAGVVAVGG 344

  Fly   304 FSNKLHILKDF 314
            :...:.::..|
plant   345 YGGIVDVISQF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thoc6NP_001261750.1 WD40 <45..325 CDD:225201 78/297 (26%)
WD40 <115..265 CDD:295369 46/154 (30%)
WD40 repeat 159..194 CDD:293791 13/35 (37%)
WD40 repeat 209..244 CDD:293791 11/36 (31%)
WD40 repeat 249..280 CDD:293791 8/32 (25%)
WD40 repeat 286..320 CDD:293791 6/31 (19%)
DWA1NP_849989.1 WD40 repeat 26..88 CDD:293791 7/38 (18%)
WD40 40..306 CDD:421866 72/280 (26%)
WD40 repeat 163..199 CDD:293791 10/35 (29%)
WD40 repeat 204..240 CDD:293791 13/35 (37%)
WD40 repeat 251..285 CDD:293791 11/35 (31%)
WD40 repeat 292..321 CDD:293791 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0649
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2182
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D760323at2759
OrthoFinder 1 1.000 - - FOG0007004
OrthoInspector 1 1.000 - - oto4027
orthoMCL 1 0.900 - - OOG6_106439
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.