DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thoc6 and Tle2

DIOPT Version :9

Sequence 1:NP_001261750.1 Gene:thoc6 / 39394 FlyBaseID:FBgn0036263 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_011241731.1 Gene:Tle2 / 21886 MGIID:104635 Length:843 Species:Mus musculus


Alignment Length:270 Identity:60/270 - (22%)
Similarity:103/270 - (38%) Gaps:78/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLAQAISGSKQYLFAGNLFGDIFVLRIKELDKGSEEPPGKL------------KIFPQGSDVDIN 65
            |.|..||.|.|:::.|.. |.:.|..:.:  .||:.|..:|            |:.|.|..    
Mouse   484 VCAVTISSSTQHVYTGGK-GCVKVWDVGQ--PGSKTPVAQLDCLNRDNYIRSCKLLPDGQS---- 541

  Fly    66 YLAFHRDFLIVGAVGLIYGLEWNEEEESLATKRSWEVKIPMQVDAVEV----PDVNSMWLDSENS 126
                    ||||.              ..:|...|::..|......|:    |...::.:..:..
Mouse   542 --------LIVGG--------------EASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAK 584

  Fly   127 ILFAGCGDGVIYQVSLEDGRIQREYRGHTDYVHSV-VGNANGQIFSGAEDGTVRVWSTKQ----Q 186
            :.|:.|.||.|....|::..:.|:::||||....: :.:...::::|..|.|||.|..::    |
Mouse   585 VCFSCCSDGNIVVWDLQNQAMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQLQ 649

  Fly   187 QHTSMLEPYKNPNLLRPDWGKWIGAV--AVNEDWLLCG-GGPKASIFHLRSMESTCVFSFPGRVH 248
            ||               |:...|.::  ..|:|||..| ......:.|:|..|     .:..|:|
Mouse   650 QH---------------DFSSQIFSLGHCPNQDWLAVGMESSHVEVLHVRKPE-----KYQLRLH 694

  Fly   249 LCDFVDDCVL 258
                 :.|||
Mouse   695 -----ESCVL 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thoc6NP_001261750.1 WD40 <45..325 CDD:225201 51/238 (21%)
WD40 <115..265 CDD:295369 35/152 (23%)
WD40 repeat 159..194 CDD:293791 9/39 (23%)
WD40 repeat 209..244 CDD:293791 9/37 (24%)
WD40 repeat 249..280 CDD:293791 3/10 (30%)
WD40 repeat 286..320 CDD:293791
Tle2XP_011241731.1 TLE_N 1..152 CDD:367727
PHA03247 <269..459 CDD:223021
WD40 466..723 CDD:392136 60/270 (22%)
WD40 repeat 484..523 CDD:293791 13/41 (32%)
WD40 repeat 531..569 CDD:293791 11/63 (17%)
WD40 repeat 574..610 CDD:293791 7/35 (20%)
WD40 repeat 617..652 CDD:293791 9/49 (18%)
WD40 repeat 657..692 CDD:293791 9/39 (23%)
WD40 repeat 698..724 CDD:293791 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.