DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thoc6 and thoc6

DIOPT Version :9

Sequence 1:NP_001261750.1 Gene:thoc6 / 39394 FlyBaseID:FBgn0036263 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_031749611.1 Gene:thoc6 / 100498236 XenbaseID:XB-GENE-1010273 Length:333 Species:Xenopus tropicalis


Alignment Length:325 Identity:104/325 - (32%)
Similarity:162/325 - (49%) Gaps:22/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KDLKRAYNNVLAQAISGSKQYLFAGNLFGDIFVLRI--------KELDKGSEEPPGKLKIFPQGS 60
            :.|:..:..|.:|..|...:||.|||..|.|.|..:        |||   |::|   :.||...|
 Frog    11 RSLELLHMTVFSQCFSPCGKYLVAGNNLGQIGVFSLSAALSSEAKEL---SKQP---VAIFQAHS 69

  Fly    61 DVDINYLAFHRDFLIVGAVGLIYGLEWNEEEESLATKRSWEVKIPMQVDAVEVPDVNSMWL-DSE 124
            ....:.::..|..:..|. ..:.|..||:.::...| :.|...||.:.: :|.|::|||.| :.:
 Frog    70 GPIYSLISTERHLISSGG-NEVKGWNWNDIQKKGCT-QLWTRCIPSRSN-LESPEINSMILNEKD 131

  Fly   125 NSILFAGCGDGVIYQVSLEDGRIQREYRGHTDYVHSV-VGNANGQIFSGAEDGTVRVWSTKQQQH 188
            ||:|.|| |...|:.:.||.|.......||.||:|.: :.....:..||.||||||:|..:....
 Frog   132 NSLLLAG-GTCNIHSMDLESGTFTMALEGHEDYIHCLALREQQRECVSGGEDGTVRIWDLRNGAQ 195

  Fly   189 TSMLEPYKNPNLLRPDWGKWIGAVAVNEDWLLCGGGPKASIFHLRSMESTCVFSFPGRVHLCDFV 253
            |..:|.||.....||.:||||..:..:.||::||||||.|::||||:..|.:|..........|.
 Frog   196 THKIEVYKYEECARPQYGKWISCLTTDSDWMVCGGGPKLSLWHLRSVTPTTIFPLNESQQQVMFY 260

  Fly   254 DDCVLIGGEHNHVQSYTLNGVLQANIPVEHTACYS-AVWQTS-PIKFISIAGFSNKLHILKDFRF 316
            .|.:|..|:..:|....:||.::|.||......|| :|.:.| ..|.::.||...|:.:..:||:
 Frog   261 QDMILCAGQGPYVNHCQINGDIKAQIPSTPRCVYSLSVNEASQENKVLTAAGSGPKIDVFTNFRY 325

  Fly   317  316
             Frog   326  325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thoc6NP_001261750.1 WD40 <45..325 CDD:225201 89/276 (32%)
WD40 <115..265 CDD:295369 57/151 (38%)
WD40 repeat 159..194 CDD:293791 11/35 (31%)
WD40 repeat 209..244 CDD:293791 16/34 (47%)
WD40 repeat 249..280 CDD:293791 8/30 (27%)
WD40 repeat 286..320 CDD:293791 10/33 (30%)
thoc6XP_031749611.1 WD40 repeat 21..67 CDD:293791 17/53 (32%)
WD40 <25..268 CDD:421866 84/252 (33%)
WD40 repeat 72..118 CDD:293791 9/45 (20%)
WD40 repeat 123..158 CDD:293791 14/35 (40%)
WD40 repeat 164..203 CDD:293791 13/39 (33%)
WD40 repeat 211..249 CDD:293791 18/37 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7997
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11533
Inparanoid 1 1.050 152 1.000 Inparanoid score I4242
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D447320at33208
OrthoFinder 1 1.000 - - FOG0007004
OrthoInspector 1 1.000 - - oto102346
Panther 1 1.100 - - LDO PTHR44411
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4782
SonicParanoid 1 1.000 - - X5889
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.