DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Est-P and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_788501.1 Gene:Est-P / 39393 FlyBaseID:FBgn0000594 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:229 Identity:61/229 - (26%)
Similarity:91/229 - (39%) Gaps:64/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YKPK--KPNRSSFPVVVLLHGGAFMFGSGSIYGHDSIMREGTLLVVKISFGLGPLGFASTGDRHL 170
            |.|:  ..:.|..||||.::|||:..|..|||         .||.::::..|...........:.
Zfish   106 YSPRLELSDESPVPVVVFVYGGAWGSGDRSIY---------CLLALQMAKELNASVICPDYSIYP 161

  Fly   171 PGNY--GLKDQRLALQWIKKNIAHFGGMPDNIVLIGHSAGGASAHLQLL---------------- 217
            .||.  .::|...:|.|:::....|....|||:|||||||   |||..|                
Zfish   162 KGNVLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAG---AHLCALTSLFLASNVEELFIET 223

  Fly   218 --HEDFKHLAKGAISVSG--NALDPWVIQQGGRRRAFELGRIVGCGH--------------TNVS 264
              .:|.....||.|.:||  :.:|.:   ...:.||.|   .|...|              |::.
Zfish   224 NKQKDLVTAIKGIIGLSGVYSIMDHY---NHEKVRAVE---YVSTMHKAMDGVENFDYYSPTSLL 282

  Fly   265 AELK-DCLKSKP-------ASDIVSAVRSFLVFS 290
            .::| |.||..|       .:||:..|.|.:.||
Zfish   283 KKMKEDQLKRVPPMALFHGTNDIIVPVESSVRFS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Est-PNP_788501.1 Esterase_lipase 26..537 CDD:238191 61/229 (27%)
Aes <107..>240 CDD:223730 44/155 (28%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 61/229 (27%)
Abhydrolase 121..>210 CDD:304388 32/100 (32%)
Abhydrolase 167..336 CDD:304388 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.