DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Est-P and AADACL3

DIOPT Version :10

Sequence 1:NP_788501.1 Gene:Est-P / 39393 FlyBaseID:FBgn0000594 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001096640.2 Gene:AADACL3 / 126767 HGNCID:32037 Length:407 Species:Homo sapiens


Alignment Length:117 Identity:31/117 - (26%)
Similarity:51/117 - (43%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LTVSIYKPKKPNRSSFPVVVLLHGGAFMFGSGSIYGHDSI----MREGTLLVVKISFGLGPLGFA 163
            :.|.:|:||....:..|.:|..|||..:.  ||:..|..|    .:|...:|:.:          
Human    97 IPVKLYQPKASTCTLKPGIVYYHGGGGVM--GSLKTHHGICSRLCKESDSVVLAV---------- 149

  Fly   164 STGDRHLPGN---YGLKDQRLALQWIKKNIAHFGGMPDNIVLIGHSAGGASA 212
              |.|.||.:   ..::|..:|.....|::..:|..|..:|:.|.|.|||.|
Human   150 --GYRKLPKHKFPVPVRDCLVATIHFLKSLDAYGVDPARVVVCGDSFGGAIA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Est-PNP_788501.1 Esterase_lipase 26..537 CDD:238191 31/117 (26%)
AADACL3NP_001096640.2 Abhydrolase_3 115..378 CDD:400284 26/99 (26%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 1/1 (100%)

Return to query results.
Submit another query.