DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Est-6 and PCME

DIOPT Version :9

Sequence 1:NP_001261749.1 Gene:Est-6 / 39392 FlyBaseID:FBgn0000592 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_197090.2 Gene:PCME / 831443 AraportID:AT5G15860 Length:427 Species:Arabidopsis thaliana


Alignment Length:305 Identity:74/305 - (24%)
Similarity:119/305 - (39%) Gaps:55/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GEEDCLTVSVYKPKNSKRNSFPVVAHIHGGAFMFG-AAWQNGHENVMREGKFILVKISYRLGPLG 164
            |::....:.:|.|.|:. ...|||..:.|||::.| .||.:.....:.|...|:..:.||..|.|
plant   136 GDQPRNRLDLYLPSNND-GLKPVVVFVTGGAWIIGYKAWGSLLGMQLAERDIIVACLDYRNFPQG 199

  Fly   165 FVSTGDRDLPGNYGLKDQRLALKWIKQNIASFGGEPQNVLLVGHSAGGASVHLQMLREDFGQLAR 229
            .:|    |:     :.|....:.::..||::|||:|..:.|:|.|||.......:|.:...:|..
plant   200 TIS----DM-----VTDASQGISFVCNNISAFGGDPNRIYLMGQSAGAHIAACALLEQATKELKG 255

  Fly   230 AAFSFSGNALDPWVIQKGA------------RG--RAFELGRNVGCESAE---DSTSLKKCLKSK 277
            .:.|::.:.:..:....|.            ||  |:..|....|.||.|   ....||..:..|
plant   256 ESISWTVSQIKAYFGLSGGYNLYKLVDHFHNRGLYRSIFLSIMEGEESFEKFSPEVRLKDPVVGK 320

  Fly   278 PASELVTAVRKFLIFSYVPFAPFS-PVLEPSDAPDAI--ITQDPRDVIKSGK-----FGQVPWAV 334
            .||.|..      |..:...:.:| |..|.....||:  :......|:.|||     |.|.|.. 
plant   321 AASLLPP------IILFHGSSDYSIPCDESKTFTDALQAVGAKAELVLYSGKTHTDLFLQDPLR- 378

  Fly   335 SYVTEDGGYN------AALLLKERKSGIVIDDLNERWLELAPYLL 373
                  ||.:      .:::..|...|:..|.|......|.|.||
plant   379 ------GGKDELFDDIVSVIHAEDNDGLTKDSLAPPRKRLVPELL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Est-6NP_001261749.1 Esterase_lipase 29..537 CDD:238191 74/305 (24%)
Aes <110..>243 CDD:223730 35/133 (26%)
PCMENP_197090.2 Aes 130..368 CDD:223730 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2946
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.