DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Est-6 and ICME-LIKE2

DIOPT Version :9

Sequence 1:NP_001261749.1 Gene:Est-6 / 39392 FlyBaseID:FBgn0000592 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_186890.2 Gene:ICME-LIKE2 / 821191 AraportID:AT3G02410 Length:422 Species:Arabidopsis thaliana


Alignment Length:407 Identity:76/407 - (18%)
Similarity:126/407 - (30%) Gaps:170/407 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PVVAHIHGGAFMFG-AAWQNGHENVMREGKFILVKISYRLGPLGFVSTGDRDLPGNYGLKDQRLA 185
            |||..:.|||::.| .||.:.....:.|...|:..:.||..|.|.:|    |:     :.|....
plant   151 PVVVFVTGGAWIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQGTIS----DM-----VSDAAQG 206

  Fly   186 LKWIKQNIASFGGEPQNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALDPWVIQKGARG 250
            :.::..||::|||:|..:.|:|.|||   .|:                 |..||           
plant   207 ISFVCNNISAFGGDPNRIYLMGQSAG---AHI-----------------SSCAL----------- 240

  Fly   251 RAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPFSPVLEPSDAPDAIIT 315
              ||                                                             
plant   241 --FE------------------------------------------------------------- 242

  Fly   316 QDPRDVIKSGKFGQVPWAVS----YVTEDGGYNAALLL-----------------------KERK 353
                ..||..:...:.|:||    |....||||...|:                       |:..
plant   243 ----QAIKESRGESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFKQFS 303

  Fly   354 SGIVIDDLNER-WLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQRFDIESYSELQRLFTDIL 417
            ..:.:.|||.| ...|.|:::.:..:.      |||..                .|..:.|||.|
plant   304 PEVRLKDLNVRKAAALLPHIILFHGSA------DYSIP----------------PEASKTFTDAL 346

  Fly   418 FKNSTQESLDLHRKYGKSPAYAYVYDNPAEKGIAQVLANRTDYDFGTVHGDDYFLIFENFVRDVE 482
            .....:..|.:::  ||:....::.| |...|..::.    |:....:|.||     .:.:|:..
plant   347 QAAEVKAELVMYK--GKTHTDLFLQD-PLRGGKDELF----DHIVSMIHADD-----SDALRNDA 399

  Fly   483 MRPDEQIISRNFINMLA 499
            :.|..:.:...|:..||
plant   400 VAPPRKRLVPEFLLKLA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Est-6NP_001261749.1 Esterase_lipase 29..537 CDD:238191 76/407 (19%)
Aes <110..>243 CDD:223730 33/121 (27%)
ICME-LIKE2NP_186890.2 Aes 125..363 CDD:223730 64/342 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2946
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.