DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6910 and MIOX5

DIOPT Version :9

Sequence 1:NP_648556.3 Gene:CG6910 / 39391 FlyBaseID:FBgn0036262 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_200475.1 Gene:MIOX5 / 835765 AraportID:AT5G56640 Length:314 Species:Arabidopsis thaliana


Alignment Length:260 Identity:133/260 - (51%)
Similarity:172/260 - (66%) Gaps:5/260 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KFRDYSMDTTDPLKERVRQTYRQMHLNQTVDFVKGRREHWLKFNTIKMTVREALEKLNDLVDESD 95
            :||||: ||....::.|...|...|.|||:|||:..|..:.|.:.:.|.:.|..|...::|||||
plant    52 QFRDYT-DTNSERQKSVEHFYATQHTNQTLDFVQKMRSEYGKLDKMVMNIWECCELSKEVVDESD 115

  Fly    96 PDLDLPNIIHAFQAAERARAEFPEHDWLHLTALIHDLGKIMA---FYGEPQWAVVGDTFAVGCRW 157
            ||||.|.|.|..|:||..|.::|..||||||||||||||::.   |.|.||||||||||.|||.:
plant   116 PDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAF 180

  Fly   158 GDSIVYRDESFEGNPDGDNPAYNTELGIYQPNCGVDNLLMSWGHDEYMYSVLKHNKTKLPHVACN 222
            .:|.|:. :.|..|||.:||.|||:.|||...||::|:|||||||:|||.|.|.|.:.||.....
plant   181 DESNVHH-KYFMENPDFNNPKYNTKAGIYSEGCGLENVLMSWGHDDYMYLVAKENGSTLPSPGLF 244

  Fly   223 IIRFHSFYPWHNGGDYKHLEAPQDAETKKWVLIFNRYDLYTKSEVVPDIEALWPYYQTLIDKYLP 287
            |||:|||||.|..|.|.||...:|.|..||:.:||:||||:||:|..::|.:.|||.:||.||.|
plant   245 IIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVNVEKVKPYYMSLIKKYFP 309

  Fly   288  287
            plant   310  309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6910NP_648556.3 MIOX 44..292 CDD:282944 127/247 (51%)
MIOX5NP_200475.1 MIOX 64..314 CDD:282944 127/247 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 282 1.000 Domainoid score I390
eggNOG 1 0.900 - - E1_KOG1573
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 285 1.000 Inparanoid score I853
OMA 1 1.010 - - QHG55321
OrthoDB 1 1.010 - - D1436589at2759
OrthoFinder 1 1.000 - - FOG0004141
OrthoInspector 1 1.000 - - otm3450
orthoMCL 1 0.900 - - OOG6_104704
Panther 1 1.100 - - O PTHR12588
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2893
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.