DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6910 and gcy-37

DIOPT Version :9

Sequence 1:NP_648556.3 Gene:CG6910 / 39391 FlyBaseID:FBgn0036262 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_500171.2 Gene:gcy-37 / 191658 WormBaseID:WBGene00001557 Length:708 Species:Caenorhabditis elegans


Alignment Length:84 Identity:20/84 - (23%)
Similarity:35/84 - (41%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RDYSMDTTDPLK----------ERVRQTYRQM--HLNQTVDFVKGRREHWLKFNTIKMTVREALE 85
            |:|.::....||          ..::.||:.:  :||....|   :.:|..|.|.::....||.:
 Worm   253 REYGLENKKTLKVSDLMQLVQPSDIQLTYKNVLSYLNTLFIF---QLKHHSKRNEVQEGSSEAFQ 314

  Fly    86 KLNDLVDESDPDLDLPNII 104
            :...|..|..|..|..:||
 Worm   315 QPLVLKGEMMPINDGNSII 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6910NP_648556.3 MIOX 44..292 CDD:282944 17/73 (23%)
gcy-37NP_500171.2 HNOB 3..165 CDD:285002
HNOBA 223..419 CDD:285003 20/84 (24%)
CYCc 400..577 CDD:214485
Nucleotidyl_cyc_III 425..609 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.