DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ACA7

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:274 Identity:76/274 - (27%)
Similarity:125/274 - (45%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QDFGYE--GRHGPEHWSE---DYARC-SGKHQSPINI--DQVSAVEKKFPKLEFFNFKVVPDNLQ 82
            ::|.|:  ...|||.|.|   ::..| .|:.||||::  ::|:.|.    .|...|....|.|..
plant    38 REFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPIDLMNERVNIVS----HLGRLNRDYNPSNAT 98

  Fly    83 MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAEL 147
            :.|.||.:::|.   ||...:::..        |:::|....||..    .||..||.|.:..||
plant    99 LKNRGHDIMLKF---EDGAGTIKIN--------GFEYELQQLHWHS----PSEHTINGRRFALEL 148

  Fly   148 HVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKST------GGYEGFTNLLSQIDRKGKSVNMT 206
            |:|...           ::..:||:...:::|...|      ...||    :::::...|:|.|.
plant   149 HMVHEG-----------RNRRMAVVTVLYKIGRADTFIRSLEKELEG----IAEMEEAEKNVGMI 198

  Fly   207 NP--LPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDHLKN 269
            :|  :.:|.      ..|:.||||||||||::.|||........:|.||:...|:  |..|...:
plant   199 DPTKIKIGS------RKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRV--AVHDDANS 255

  Fly   270 NFRPIQPLNDRTLY 283
            |.||:||.|.|.::
plant   256 NARPVQPTNKRIVH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 75/268 (28%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.