DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ACA8

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:280 Identity:69/280 - (24%)
Similarity:106/280 - (37%) Gaps:88/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DFGYE--GRHGPEHW---SEDYARCS-GKHQSPINI-DQVSAVEKKFPKLEFFNFKVVPDNLQMT 84
            :|.||  |..||..|   ..::..|. ||.||||:: |:...|..||..|   ..:.:|.|..:.
plant   139 EFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFGLL---RSQYLPSNTTIK 200

  Fly    85 NNGHTVLVKMSYNEDEI-PSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELH 148
            |.||.:::|.......| .::||        ..||.:|.|:|      ..||..||.:.:..|.|
plant   201 NRGHDIMLKFKGGNKGIGVTIRG--------TRYQLQQLHWH------SPSEHTINGKRFALEEH 251

  Fly   149 VVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGE 213
            :|..:           ||...||:||.:.:|....        .|..::::.|.:..|:      
plant   252 LVHES-----------KDKRYAVVAFLYNLGASDP--------FLFSLEKQLKKITDTH------ 291

  Fly   214 YISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDHLKNNFRPIQPLN 278
                                .|||    ...|   ::.||:...|:  |..|...:|.||:|.:|
plant   292 --------------------ASEE----HIRT---VSSKQVKLLRV--AVHDASDSNARPLQAVN 327

  Fly   279 DRTLY---------KNYIEI 289
            .|.:|         |.|..|
plant   328 KRKVYLYKPKVKLMKKYCNI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 64/260 (25%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.