DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ACA3

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_196038.1 Gene:ACA3 / 830296 AraportID:AT5G04180 Length:277 Species:Arabidopsis thaliana


Alignment Length:303 Identity:79/303 - (26%)
Similarity:124/303 - (40%) Gaps:77/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVIAPILICASLVLAQ----DFGYEGRH--GPEHWSE---DYARC-SGKHQSPINIDQVSAVEKK 65
            |:....|..:|..||.    :|.|:...  .|..||.   ::..| :||.|||||:.        
plant     5 ILFVTFLALSSSSLADETETEFHYKPGEIADPSKWSSIKAEWKICGTGKRQSPINLT-------- 61

  Fly    66 FPKL--------EFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQF 122
             ||:        |.......|....:.|.|..:.||.   ||:    .|..:...|  .|:..|.
plant    62 -PKIARIVHNSTEILQTYYKPVEAILKNRGFDMKVKW---EDD----AGKIVINDT--DYKLVQS 116

  Fly   123 HFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYE 187
            |:|      ..||..::.:....|||:|.:::|          .| :||:...|:.|:.:.    
plant   117 HWH------APSEHFLDGQRLAMELHMVHKSVE----------GH-LAVIGVLFREGEPNA---- 160

  Fly   188 GFTNLLSQI-DRKGK---------SVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWID 242
                .:|:| |:..|         |:...:|...|..::|    ::.|.||||||||:|:|.|..
plant   161 ----FISRIMDKIHKIADVQDGEVSIGKIDPREFGWDLTK----FYEYRGSLTTPPCTEDVMWTI 217

  Fly   243 FTTPIDITEKQLNAFRLLTANDDHLKNNFRPIQPLNDRTLYKN 285
            ......::.:|::.  |..|.....:.|.||.||||.|.:|.|
plant   218 INKVGTVSREQIDV--LTDARRGGYEKNARPAQPLNGRLVYLN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 71/276 (26%)
ACA3NP_196038.1 alpha_CA_prokaryotic_like 35..257 CDD:239398 70/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.