DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ACA6

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:273 Identity:72/273 - (26%)
Similarity:116/273 - (42%) Gaps:79/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FAIVIAPILICASLVLAQDFG------YEGR--HGPEHWSE---DYARCS-GKHQSPINI--DQV 59
            |..:.:|.::   .|.|::.|      |:.:  .||..|.:   .:..|| ||.||||::  ::|
plant    15 FIDLFSPNIL---FVYAREIGNKPLFTYKQKTEKGPAEWGKLDPQWKVCSTGKIQSPIDLTDERV 76

  Fly    60 SAV-EKKFPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLA-EKTPLGYQFEQF 122
            |.: ::...|    ::|  |.:..:.:.||.|:|  |:..|      ||.:. .:|  .|:..|.
plant    77 SLIHDQALSK----HYK--PASAVIQSRGHDVMV--SWKGD------GGKITIHQT--DYKLVQC 125

  Fly   123 HFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYE 187
            |:|      ..||..||..:|..|||:|        ..||..|   ..|:...:::|:..    |
plant   126 HWH------SPSEHTINGTSYDLELHMV--------HTSASGK---TTVVGVLYKLGEPD----E 169

  Fly   188 GFTNLLSQIDRKGK---SVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTW--------- 240
            ..|.:|:.|...||   .:.:.:|    ..|.....:::.|.||||.|||:|.|.|         
plant   170 FLTKILNGIKGVGKKEIDLGIVDP----RDIRFETNNFYRYIGSLTIPPCTEGVIWTVQKRVLYF 230

  Fly   241 -------IDFTTP 246
                   |.|.||
plant   231 FCFCYRLIIFVTP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 68/254 (27%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 68/263 (26%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 62/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.