DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ACA4

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_193831.1 Gene:ACA4 / 827846 AraportID:AT4G20990 Length:267 Species:Arabidopsis thaliana


Alignment Length:267 Identity:76/267 - (28%)
Similarity:119/267 - (44%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGYEGR--HGPEHWSE---DYARC-SGKHQSPINI--DQVSAVEKKFPKLEFFNFKVVPDNLQMT 84
            |.||.:  .|||.|.:   .:..| :|::||||::  ::||.:..     :.:..:..|....:|
plant    36 FTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDLTNERVSLIHD-----QAWTRQYKPAPAVIT 95

  Fly    85 NNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHV 149
            |.||.::|  |:..|     .|.....||  .:...|.|:|      ..||..:|...|..|||:
plant    96 NRGHDIMV--SWKGD-----AGKMTIRKT--DFNLVQCHWH------SPSEHTVNGTRYDLELHM 145

  Fly   150 VLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKG-KSVN--MTNPLPL 211
            |        ..||..:   .||:...:::|:.:    |..|.||:.|...| |.:|  |.:|   
plant   146 V--------HTSARGR---TAVIGVLYKLGEPN----EFLTKLLNGIKAVGNKEINLGMIDP--- 192

  Fly   212 GEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDHLKNNFRPIQP 276
             ..|......::.|.||||.|||:|.|.|........|:.:|:.|.|  .|.||..:.|.||:|.
plant   193 -REIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQITALR--QAVDDGFETNSRPVQD 254

  Fly   277 LNDRTLY 283
            ...|:::
plant   255 SKGRSVW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 75/263 (29%)
ACA4NP_193831.1 PLN02179 1..226 CDD:177835 64/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.