DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca13

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001072448.1 Gene:ca13 / 779902 XenbaseID:XB-GENE-992707 Length:263 Species:Xenopus tropicalis


Alignment Length:275 Identity:93/275 - (33%)
Similarity:139/275 - (50%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQMT-NNG 87
            :...:|||..:|||.|.:.:...:|..||||||....|:..  |.|:........|:.::. |.|
 Frog     1 MMHQWGYEDHNGPEVWHDLFPLANGDRQSPINIITRDAIYD--PSLQPLQVNYDHDSAKVVINTG 63

  Fly    88 HTVLVKMSYNEDEIPSVRGGPLAEKTPLG-YQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVL 151
            ||..::.. :.|:...:||||.     :| |:..|||||||.:|..|||..::...|.||||:|.
 Frog    64 HTFTMEFD-DGDDTSVLRGGPF-----IGSYRLRQFHFHWGSSDGHGSEHKVDGMDYAAELHIVH 122

  Fly   152 RNLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGY-EGFTNLLSQIDRKGKSVNMTNPLPLGEY 214
            .|.| :..|..|.....|:||:..|.::|:.:.  | |..|:....|..|||....||..|  ..
 Frog   123 WNSEKFSSFVEAACAPDGLAVLGVFLKIGEPNR--YIERITDTFGAIRSKGKQSPFTNFDP--SC 183

  Fly   215 ISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDH-------LKNNFR 272
            :..:...:::|.||||.||..|.|||:....||.|:.:||..||.|....|.       :|:|.|
 Frog   184 LLPASMDFWTYPGSLTVPPLLESVTWVVLKEPISISHEQLARFRSLLFTKDTAEIEACCMKSNHR 248

  Fly   273 PIQPLNDRTLYKNYI 287
            |:|||.:|.:..:::
 Frog   249 PVQPLKNRKVRASFL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 92/263 (35%)
ca13NP_001072448.1 alpha_CA 1..262 CDD:320708 93/272 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.