DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CA11

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001208.2 Gene:CA11 / 770 HGNCID:1370 Length:328 Species:Homo sapiens


Alignment Length:280 Identity:76/280 - (27%)
Similarity:126/280 - (45%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPEHW---SEDYARCS-GKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVKMS 95
            ||..|   :..::.|: ||.|||::::....:...|          :|. |:::..|..:...: 
Human    48 GPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPF----------LPP-LRLSTGGEKLRGTL- 100

  Fly    96 YNEDE----------IPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVV 150
            ||...          :.:|.||||.    ..::..:....:|..|..|||..||::.:.||:.::
Human   101 YNTGRHVSFLPAPRPVVNVSGGPLL----YSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLI 161

  Fly   151 LRNLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTN--LLSQIDRKGK-------SVNM 205
            ..|.| |.:|::|....:|:|:::.|..|...|........|  .:::|..|..       |:.:
Human   162 HFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLEL 226

  Fly   206 TNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND-----D 265
            ..|...|         :.:|.|||:||||||.||||.....::||..|:::.|||:.|.     .
Human   227 LFPESFG---------FITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQ 282

  Fly   266 HLKNNFRPIQPLNDRTLYKN 285
            .|..|.||:|||..|.|..|
Human   283 SLSGNSRPLQPLAHRALRGN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 73/274 (27%)
CA11NP_001208.2 alpha_CARP_X_XI_like 48..304 CDD:239395 76/280 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..328 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.