DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca15c

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001070801.1 Gene:ca15c / 768190 ZFINID:ZDB-GENE-061013-737 Length:324 Species:Danio rerio


Alignment Length:265 Identity:90/265 - (33%)
Similarity:135/265 - (50%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDN---LQMTNNGHTVLVKMSYN 97
            |.|       |:|..||||||  |:|..::.|.|..||......|   ..:||.|.:|:|.:   
Zfish    43 PHH-------CNGSSQSPINI--VTAQVQENPNLTQFNLTGFDANTTFTSITNAGVSVVVNL--- 95

  Fly    98 EDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTI-GSEDLINNRAYPAELHVVLRNLEY---PD 158
            :|:|.||:||.|    |..|..:.||.|||...:: |||..:|.:.|..|||:|..:.:|   ..
Zfish    96 DDKIMSVQGGDL----PGLYVSKNFHLHWGSGSSLPGSEHTVNGKQYAMELHIVNVHSKYNGSVS 156

  Fly   159 FASALDKDHGIAVMAFFFQVGDKS--TGGYEGFTNLLSQIDRKG-KSVNMTNPLPLG---EYISK 217
            .|.|......:||:.||.:..|::  |.|::..|:.|::|..|. .:|::.|.:.:.   |.:.|
Zfish   157 VALAAHDSSALAVLGFFIEGTDEANKTKGWDVLTSFLTKIPNKNDTTVDIMNQITMNSLLEGVDK 221

  Fly   218 SVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLN-----AFRLLTANDDHLKNNFRPIQPL 277
            :  .|:.|.||||||.|:|.|.|..|..||.::...:|     .|...|:....:.||||.:|||
Zfish   222 T--KYYRYQGSLTTPDCNEAVIWTVFKEPIKVSNNLINRFSTTVFTKTTSAPVLIFNNFRGVQPL 284

  Fly   278 NDRTL 282
            |.|.:
Zfish   285 NGRVV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 89/262 (34%)
ca15cNP_001070801.1 alpha_CA_IV_XV_like 48..291 CDD:239391 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.