DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and zgc:153760

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001070086.1 Gene:zgc:153760 / 767680 ZFINID:ZDB-GENE-060929-528 Length:324 Species:Danio rerio


Alignment Length:304 Identity:97/304 - (31%)
Similarity:154/304 - (50%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CSGKHQSPINIDQVSAVEKKFPKLEFF---NFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGG 107
            |:|..||||:|  |:|..:..|.|..|   .|........:||:|.:|:|.:   :::|.||:||
Zfish    46 CNGSSQSPIDI--VTAQVQGNPNLTQFILTGFDANTTFTSITNSGTSVVVSL---DEDIMSVQGG 105

  Fly   108 PLAEKTPLGYQFEQFHFHWGENDTI-GSEDLINNRAYPAELHVVLRNLEY---PDFASALDKDHG 168
            .|    |..|...|||.|||.:.:: |||..::.:.|..|||:|..:..|   ...|.|.:....
Zfish   106 DL----PGLYVSVQFHLHWGSSSSLPGSEHTVDGKQYAMELHIVNLHSTYNGNVSAALAANDSSA 166

  Fly   169 IAVMAFFFQVGDKS--TGGYEGFTNLLSQIDRKGKS-------VNMTNPLPLGEYISKSVESYFS 224
            :||:.||.:..|::  |..::.||:.||.|...|.:       :.|.:.|   |.::|:  .|:.
Zfish   167 LAVLGFFIEGTDEADKTNSWDVFTSFLSNIPNSGNTYTDIMDQITMNSLL---EGVNKT--KYYR 226

  Fly   225 YTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAF------RLLTANDDHLKNNFRPIQPLNDRTLY 283
            |.||||||||:|:|.|..|..||.:....:|.|      :...|:|.:: ||||.:||||.|.: 
Zfish   227 YQGSLTTPPCNEDVIWTVFKEPIKVNNNLINRFCTKVFAKTAKASDLNV-NNFRGVQPLNGRVV- 289

  Fly   284 KNYIEIPIHNMGSIPLVDAENAAGKWRAQAAAVLLPLVVLAALS 327
            .:.:|..:           .:||....|.:.:.|..|::|::||
Zfish   290 TSQVEQTV-----------SSAAPSLVATSISSLSLLLLLSSLS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 87/256 (34%)
zgc:153760NP_001070086.1 alpha_CA_IV_XV_like 48..291 CDD:239391 87/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.