DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CA8

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:281 Identity:100/281 - (35%)
Similarity:146/281 - (51%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPD-----NLQMTNN 86
            ::|||  .|.| |...:...:|::|||||::...|  :..|.|  .:.::.|:     :.::||:
Human    28 EWGYE--EGVE-WGLVFPDANGEYQSPINLNSREA--RYDPSL--LDVRLSPNYVVCRDCEVTND 85

  Fly    87 GHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFE--QFHFHWGENDTIGSEDLINNRAYPAELHV 149
            |||:.|.:....    .:.||||    |.|::||  :..||||..:..|||..:|.:|:|.|||:
Human    86 GHTIQVILKSKS----VLSGGPL----PQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHL 142

  Fly   150 VLRNLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKS-------VNMT 206
            :..|.. :.....|:.|.||||::|.|.|:| |...|.:..|.:|..|..||||       .|..
Human   143 IHWNSTLFGSIDEAVGKPHGIAIIALFVQIG-KEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTL 206

  Fly   207 NPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAN-------- 263
            .|.||       :..|:.|.||||.|||||.||||.|..|:.|::.|:..||.|..:        
Human   207 LPDPL-------LRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVE 264

  Fly   264 --DDHLKNNFRPIQPLNDRTL 282
              |..|.:||||.|||:||.:
Human   265 GCDGILGDNFRPTQPLSDRVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 99/277 (36%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 96/272 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.