DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CA6

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_011540386.1 Gene:CA6 / 765 HGNCID:1380 Length:324 Species:Homo sapiens


Alignment Length:289 Identity:86/289 - (29%)
Similarity:142/289 - (49%) Gaps:32/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILICASLVL-------AQDFGY-EGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFF 72
            :::..||.|       ..|:.| ||.....||.:.|..|.|:.|||||:.:...  :..|.|:..
Human     8 LVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKV--RYNPSLKGL 70

  Fly    73 N---FKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWG--ENDTI 132
            |   ::.......|.||||||.:       .:||.....:|:.|.  |..:|.|||||  .::..
Human    71 NMTGYETQAGEFPMVNNGHTVQI-------SLPSTMRMTVADGTV--YIAQQMHFHWGGASSEIS 126

  Fly   133 GSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGD-KSTGGYEGFTNLLSQI 196
            |||..::...:..|:|:|..|.:|..:..|.|...|:||:|.|.:|.: .....|..|.:.|:.|
Human   127 GSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANI 191

  Fly   197 DRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLT 261
            ...|:...:|. |.:.:.:.::::.|::|.||||||||:|.|.|......:.::..|:  ::|..
Human   192 KYPGQRTTLTG-LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQV--WKLEN 253

  Fly   262 ANDDH----LKNNFRPIQPLNDRTLYKNY 286
            :..||    :.|::|..||||.|.:..|:
Human   254 SLLDHRNKTIHNDYRRTQPLNHRVVESNF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 80/263 (30%)
CA6XP_011540386.1 alpha_CA_VI 35..283 CDD:239399 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.