DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Car12

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006511611.1 Gene:Car12 / 76459 MGIID:1923709 Length:355 Species:Mus musculus


Alignment Length:309 Identity:98/309 - (31%)
Similarity:160/309 - (51%) Gaps:29/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YEGRHGPEHWSEDYARCSGKHQSPINI-DQVSAVEKKFPKLEFFNFKV-VPDNLQMTNNGHTVLV 92
            |.|..|.::||:.|..|.|..||||:: ..:...:.....|:|..:.| |...|.:||:||:  |
Mouse    34 YVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHS--V 96

  Fly    93 KMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWG-ENDTIGSEDLINNRAYPAELHVVLRNLE- 155
            :::.|.|..  ::|     ..|..|:.||.|.||| .||..|||..::.:.:.||||:|..|.: 
Mouse    97 RLNLNSDMY--IQG-----LQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDL 154

  Fly   156 YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVE 220
            ||||::|.||..|:||:|...::| .:...|:...:.|..:..||:.| :.....:.|.:.:|..
Mouse   155 YPDFSTASDKSEGLAVLAVLIEIG-SANPSYDKIFSHLQHVKYKGQQV-LIPGFNIEELLPESPG 217

  Fly   221 SYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR---LLTANDD----HLKNNFRPIQPLN 278
            .|:.|.||||||||...|.|..|..|:.|:::||.|..   ..|..||    .:.||||.:|..:
Mouse   218 EYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFD 282

  Fly   279 DRTLYKNYIEIPIHNMGSIPLVDAENAAGKWRAQAAAVLLPLVVLAALS 327
            :|.:|.::.::.:       |.:...:.|...:.|.|.:|.:.::.|:|
Mouse   283 ERLVYISFRQVGL-------LTNTGLSLGIILSVALAGVLGISIVLAVS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 89/261 (34%)
Car12XP_006511611.1 alpha_CA 39..290 CDD:381753 89/261 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.