DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CA5A

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_011521611.1 Gene:CA5A / 763 HGNCID:1377 Length:376 Species:Homo sapiens


Alignment Length:145 Identity:47/145 - (32%)
Similarity:75/145 - (51%) Gaps:13/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WSEDYARCSGKHQSPINI---DQVSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDE 100
            |:...:...|..||||||   |.|...:.|..::.:    .....|.:.|.|:...|:.. :..|
Human    52 WTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSY----EAASCLYIWNTGYLFQVEFD-DATE 111

  Fly   101 IPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN-LEYPDFASALD 164
            ...:.||||...    |:.:|||||||..:..|||..::..|||||||:|..| ::|.::..|:.
Human   112 ASGISGGPLENH----YRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVV 172

  Fly   165 KDHGIAVMAFFFQVG 179
            .::|:||:..|.::|
Human   173 GENGLAVIGVFLKLG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 47/145 (32%)
CA5AXP_011521611.1 alpha_CA 61..>212 CDD:294017 46/136 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.