DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CA4

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_005257696.1 Gene:CA4 / 762 HGNCID:1375 Length:336 Species:Homo sapiens


Alignment Length:308 Identity:90/308 - (29%)
Similarity:126/308 - (40%) Gaps:81/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HW-------SEDY---------ARCSGKHQSPINIDQVSA-VEKKFPKLEFFNFKVVPDNLQ--- 82
            ||       |.:|         ..|....||||||....| |:||..:..|..:    |..|   
Human    22 HWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGY----DKKQTWT 82

  Fly    83 MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAEL 147
            :.||||:|::.:    :...|:.||.|    |..||.:|.|.||.:....|||..::...:..|:
Human    83 VQNNGHSVMMLL----ENKASISGGGL----PAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEM 139

  Fly   148 HVV-------LRNLEYPDFASALDKDHGIAVMAFF------------------------FQVGDK 181
            |:|       .||::     .|.|.:..|||:||.                        ||.|.:
Human   140 HIVHEKEKGTSRNVK-----EAQDPEDEIAVLAFLVEIGRMNWPPPLAPCRLSQDPSLPFQAGTQ 199

  Fly   182 STGGYEGFTNLLSQIDRKGKSVNMTNP-----LPLGEYISKSVESYFSYTGSLTTPPCSEEVTWI 241
            ...|::.....||.|.:...|..|...     ||..|    .:..||.|.||||||.|.|:|.|.
Human   200 VNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEE----KLRHYFRYLGSLTTPTCDEKVVWT 260

  Fly   242 DFTTPIDITEKQLNAFRLLTANDDH----LKNNFRPIQPLNDRTLYKN 285
            .|..||.:..:|:.||......|..    :|:|.||:|.|..||:.|:
Human   261 VFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 87/302 (29%)
CA4XP_005257696.1 alpha_CA_IV_XV_like 48..307 CDD:239391 84/279 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.