DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca5b

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:281 Identity:97/281 - (34%)
Similarity:150/281 - (53%) Gaps:38/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YEGRHGPEH--WSEDYARCSGKHQSPINI---DQVSAVEKKFPKLEFFNFKVVPDN-LQMTNNGH 88
            |:.|:...|  |..:.....|..||||||   |.|.     .|:|...:.:..|:. |.:.|||:
 Frog    43 YKLRNVDLHPLWRGEIEVPGGSRQSPINIRIRDSVF-----HPQLAPVHTQYDPNTCLYIWNNGY 102

  Fly    89 TVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN 153
            :..|:...:.|: .:|.||||  :.|  ::.:|||||||.|:..|||..:::|.:|||||:|..|
 Frog   103 SFFVEYDDSTDK-STVSGGPL--ENP--FRLKQFHFHWGRNNDWGSEHTVDSRVFPAELHLVHWN 162

  Fly   154 L-EYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISK 217
            . :|..|..|:.:.:|:||:..|.:||..    :|....|:..:    .||...:.|....|...
 Frog   163 CSKYRTFEEAIMEPNGLAVIGVFLKVGKH----HEKLQKLVDIL----PSVRYKDALTEFNYFDS 219

  Fly   218 -----SVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR--LLTA---NDDHLKNNFR 272
                 |...|::|:|||||||.:|.||||....||::...||..||  |.||   .:.::.:|||
 Frog   220 SCLLPSCGDYWTYSGSLTTPPLTESVTWIIMKKPIEVDHSQLAVFRSLLFTAVGEEERYMVDNFR 284

  Fly   273 PIQPLNDRTLYKNY---IEIP 290
            |:|||.:||::.::   ::||
 Frog   285 PLQPLMNRTVHSSFEPALQIP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 93/267 (35%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 91/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.