DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca10a

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001032198.1 Gene:ca10a / 641327 ZFINID:ZDB-GENE-051030-123 Length:328 Species:Danio rerio


Alignment Length:310 Identity:80/310 - (25%)
Similarity:144/310 - (46%) Gaps:50/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FAIVIAPILICASLVLAQDFGYEGRHG------------PEHW---SEDYARCS-GKHQSPINID 57
            |.|:.|.:::|:|........:||...            |..|   :..:..|| ||.|||:||:
Zfish     8 FIILQANLIVCSSAQPNPPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIE 72

  Fly    58 QVSAVEKKFPKLEFFNFKVVPDNLQ---------MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKT 113
            ....:...|         :.|..|.         |.|.|..|.:::  :::.:.::.|||:.   
Zfish    73 TSHMIFDPF---------LTPLRLNTGGRKVGGTMYNTGRHVSLRL--DKEHLVNISGGPMT--- 123

  Fly   114 PLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE-YPDFASALDKDHGIAVMAFFFQ 177
             ..::.|:...|:|..|..|||.|:|.:|:..|:.::..|.| |.::..|....:|:.:::.|.:
Zfish   124 -YSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLIHYNHELYTNYTEAAKSPNGLVIVSIFMK 187

  Fly   178 VGDKSTGGYEGFTN--LLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTW 240
            :.:.|........|  .:::|..|..:. :.:.|.: |.:.....|:.:|.||:|.|||.|..||
Zfish   188 ISETSNSFLNRMLNRDTITRITYKNDAY-LLSGLNI-EEVYPETASFITYEGSMTIPPCYETATW 250

  Fly   241 IDFTTPIDITEKQLNAFRLLTANDD-----HLKNNFRPIQPLNDRTLYKN 285
            |....||.:|:.|:::.|||:.|..     .:.:|.||:||||:|.:..|
Zfish   251 ILMNKPIYVTKMQMHSMRLLSQNQPSQIFLSMSDNVRPVQPLNNRCIRTN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 73/285 (26%)
ca10aNP_001032198.1 alpha_CARP_X_XI_like 46..302 CDD:239395 73/272 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.