DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca10b

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_005164153.1 Gene:ca10b / 568543 ZFINID:ZDB-GENE-080815-2 Length:326 Species:Danio rerio


Alignment Length:271 Identity:76/271 - (28%)
Similarity:133/271 - (49%) Gaps:38/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PEHW---SEDYARCS-GKHQSPINIDQVSAVEKKF--P-KLEFFNFKVVPDNLQMTNNGHTVLVK 93
            |..|   :..:..|: ||.|||:||:....:...|  | :|.....||   :..|.|.|..|.::
Zfish    46 PSFWGLVNTAWNLCAIGKRQSPVNIETSRMIFDPFLNPLRLNAGQRKV---SGTMYNTGRHVSLR 107

  Fly    94 MSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE-YP 157
            .  ::..:.::.||||:    ..|:.|:...|:|..|..|||.|:|.:|:|.|:.::..|.: |.
Zfish   108 P--DKSHLVNISGGPLS----YSYRLEEIRLHFGSEDNRGSEHLLNGQAFPGEVQLIHYNQDLYL 166

  Fly   158 DFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNL-LSQIDRKGKSVNMTNP----LPLG---EY 214
            :::.|:...:||||::.|.::.:.        ||: |:::..:.....:|..    |.:|   |.
Zfish   167 NYSDAVRSPNGIAVVSIFMKISEP--------TNVFLNRMLNRETVTRITYKHDAYLLMGLNIEE 223

  Fly   215 ISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDD-----HLKNNFRPI 274
            :......:.:|.||:|.|||.|..|||....||.|::.::.:.|||:.|..     .:.:|.||.
Zfish   224 LYPETSRFITYEGSITIPPCLETATWILMNKPIYISQIEMQSLRLLSQNQPSQIFLSMGDNMRPT 288

  Fly   275 QPLNDRTLYKN 285
            |.|:.|.:..|
Zfish   289 QTLHQRCIRTN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 74/265 (28%)
ca10bXP_005164153.1 PLN02179 7..257 CDD:177835 63/227 (28%)
alpha_CARP_X_XI_like 45..301 CDD:239395 76/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.