DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and car15

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_005169278.1 Gene:car15 / 568143 ZFINID:ZDB-GENE-091204-152 Length:312 Species:Danio rerio


Alignment Length:289 Identity:86/289 - (29%)
Similarity:141/289 - (48%) Gaps:25/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVIAPILICASLVLAQ---DFGYEGRH-GPEHWSEDYARCS---GKHQSPINIDQVSAVEKKFPK 68
            :::..:|:.:.|:||:   ||.|:..| .|..|.:.|..|.   ..|.||||:|...........
Zfish     2 VMMILMLMMSVLLLARTDDDFCYDEDHCDPYAWGDSYPSCHPLLDSHHSPINLDHHLMKNHSLDS 66

  Fly    69 LEFFNFKVV-PDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTI 132
            |:...|.:. .....:||.||:|::::.    :...|.||.|    |..|:..|.|||||...:.
Zfish    67 LQLHGFNLTHKGQWWLTNQGHSVVLEVG----DGMQVSGGGL----PATYRTFQLHFHWGSVSSN 123

  Fly   133 GSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQID 197
            |||..:::..:|.|:|:|.....:|:..|||:...||||:..|..|.......::..::.||.:.
Zfish   124 GSEHTLDHLRFPMEMHIVNIKSTHPNLTSALEDPTGIAVLGVFVDVTYLHNENFQSISSALSYVA 188

  Fly   198 RKGKSVNMTNPLPLGEYI-SKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAF--RL 259
            .||::.:: .|.||...: ..::..|:.|.||||||||||.|.|..:..|:.|:..|...|  .:
Zfish   189 YKGQTKSI-KPFPLVNLLPQNNLTQYYRYHGSLTTPPCSEVVLWTIYEVPVYISWAQFEQFVSGI 252

  Fly   260 LTANDDH-----LKNNFRPIQPLNDRTLY 283
            .:..::.     |.:|:|.|.|...|.:|
Zfish   253 YSTEEEAEIQALLHDNYRHIHPTYSRPVY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 79/265 (30%)
car15XP_005169278.1 alpha_CA_IV_XV_like 46..282 CDD:239391 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113791
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.