DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca9

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_009303384.1 Gene:ca9 / 566612 ZFINID:ZDB-GENE-080818-5 Length:384 Species:Danio rerio


Alignment Length:294 Identity:89/294 - (30%)
Similarity:139/294 - (47%) Gaps:37/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILICASLVLAQDFGYE--GRH--GPEH-----------WSEDYARCSGKHQSPINIDQVSAV-EK 64
            :|:.:|....:|...|  |:|  |..|           |...:..|.||.|||||||....: |.
Zfish    14 LLVASSSSSEEDKSSERDGQHSKGSSHQHHWGYQDQDAWLSAFEHCGGKSQSPINIDTHKVLHEP 78

  Fly    65 KFPKLEFFNFKVV-PDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLG----YQFEQFHF 124
            :.|.::...:.:. ..:|.:.|||||:.:.:             |.:.:...|    |...|.||
Zfish    79 RLPPIQLDGYDLTGSHSLTLLNNGHTLQLSL-------------PSSMRIRRGFDQVYVAAQLHF 130

  Fly   125 HWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGF 189
            |||..:..|||..|:|..||||:|||..|.:|.:...|..|..|:||:..|..:|......||..
Zfish   131 HWGTTEVPGSEHTIDNIHYPAEIHVVHYNSKYANLTEAASKADGLAVLGGFIAIGLHENDNYEKI 195

  Fly   190 TNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQL 254
            .:.||.:..: :|:.:.....:...:..|:|.::.|:||||||||.:.|:|..|...|.::.:||
Zfish   196 LSALSDVSTE-ESLTVIPGFNVRHLLPNSLERFYRYSGSLTTPPCLQTVSWTLFNDSIRVSRRQL 259

  Fly   255 NAFR--LLTANDDHLKNNFRPIQPLNDRTLYKNY 286
            .|..  |.|.::..|..|||..|.|:.|.:..::
Zfish   260 AALEESLKTEHNKLLSKNFRAPQLLHGRKIQSSF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 85/275 (31%)
ca9XP_009303384.1 alpha_CA_IX 48..294 CDD:239403 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.