DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca7

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_957107.1 Gene:ca7 / 564201 ZFINID:ZDB-GENE-040426-1786 Length:263 Species:Danio rerio


Alignment Length:276 Identity:96/276 - (34%)
Similarity:141/276 - (51%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVP--------DNLQMT 84
            :||...:||..|.:||....|..||||:|....||         |:.|:.|        .:|.::
Zfish     6 WGYGEDNGPSAWHKDYPIAEGNRQSPIDIVPSEAV---------FDSKLSPISLSYNNCTSLSIS 61

  Fly    85 NNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHV 149
            ||||:|:|:. .:.||...:.||||...    |:.:|||||||.....|||..:..:.:.:|||:
Zfish    62 NNGHSVVVEF-VDTDERSVITGGPLENM----YRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHL 121

  Fly   150 VLRNL-EYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMT--NPLPL 211
            |..|. :|..|:.|.....|:||:..|.:.||:....:: .|:.|..:..||......  ||..|
Zfish   122 VHWNANKYKSFSEAAAAPDGLAVLGIFLETGDEHRALHQ-ITDALYMVRFKGSLAEFKGFNPKCL 185

  Fly   212 GEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDD------HLKNN 270
               :..|:| |::|.|||||||..|.||||....||.::|||:..||.|..|.:      .::||
Zfish   186 ---LPNSLE-YWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNRMENN 246

  Fly   271 FRPIQPLNDRTLYKNY 286
            :||.|||..|.:..::
Zfish   247 YRPPQPLKGRMVRASF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 95/269 (35%)
ca7NP_957107.1 alpha_CA_VII 26..262 CDD:239402 89/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.