DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca15a

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001075158.1 Gene:ca15a / 553469 ZFINID:ZDB-GENE-070424-7 Length:324 Species:Danio rerio


Alignment Length:255 Identity:87/255 - (34%)
Similarity:129/255 - (50%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDN---LQMTNNGHTVLVKMSYNEDEIPSVRGG 107
            |:|..||||||.....:|..  .|..|||.....|   :.|.|:|.:|:|.:   ::||.||:||
Zfish    46 CNGSSQSPINIVTAQVLENS--NLTQFNFTGFDANTTFISMANSGISVVVTL---DEEIMSVQGG 105

  Fly   108 PLAEKTPLGYQFEQFHFHWGENDTI-GSEDLINNRAYPAELHVVLRNLEYP---DFASALDKDHG 168
            .|    |..|..:|||.|||.:.:. |||..::.:.|..|||:|..:.:|.   ..|.|.:....
Zfish   106 DL----PGLYVSKQFHLHWGNSSSFPGSEHTVDGKQYAMELHIVNVHSKYNGSLSAALAANDSSA 166

  Fly   169 IAVMAFFFQVGDKST--GGYEGFTNLLSQIDRKGKS----VNMTNPLPLGEYISKSVESYFSYTG 227
            :||:.||.:..::::  .|:...|:.|..|...|.:    :|.|:...|.|.::|:  .|:.|.|
Zfish   167 LAVLGFFIEGTNEASKAKGWGVLTSFLRNITYSGNATVDIMNRTSMNSLLEGVNKT--KYYRYRG 229

  Fly   228 SLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLL----TANDDHLK-NNFRPIQPLNDRTL 282
            |||||.|:|.|.|..|..||.:....:|.|...    .|:...|. ||||.:||||.|.:
Zfish   230 SLTTPSCNEAVIWTVFKEPIKVNNNLINLFSTTVFAKNASAPVLNVNNFRGVQPLNGRVV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 86/252 (34%)
ca15aNP_001075158.1 alpha_CA_IV_XV_like 48..291 CDD:239391 86/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.