DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca2

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001015729.1 Gene:ca2 / 548446 XenbaseID:XB-GENE-484348 Length:260 Species:Xenopus tropicalis


Alignment Length:268 Identity:92/268 - (34%)
Similarity:135/268 - (50%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQ-MTNNG 87
            :|..:||...:||..|...:....|.|||||||  |||..|....|:..:.|..|...: :.|||
 Frog     1 MAHAWGYGPDNGPATWHHAFPIAHGDHQSPINI--VSAEAKYDHHLKPISIKYDPSTAKVILNNG 63

  Fly    88 HTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLR 152
            |...|:...:||: ..:.||.::..    |:.:|||||||..|..|||..::...|.||||:|..
 Frog    64 HAFNVEFDDSEDK-SVLSGGAVSHP----YRLKQFHFHWGSCDGHGSEHTVDGVKYEAELHLVHW 123

  Fly   153 NLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEY--- 214
            |.:|...|.|:....|:||:..|.:||: :..|.:...:.|..|..||      |..|..:|   
 Frog   124 NTKYASMAEAVKHCDGLAVVGVFLKVGE-AHPGLQKVLDALKLIPNKG------NEAPFTDYDPS 181

  Fly   215 --ISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDH-----LKNNFR 272
              :..|:: :::|.|||||||..:.|.|.....||.::.:||:..|.|..|.:.     :.:|||
 Frog   182 VLLPNSLD-FWNYKGSLTTPPLLQCVLWHVLREPIAVSNQQLSQLRSLFFNAEGDTPCCMVDNFR 245

  Fly   273 PIQPLNDR 280
            |.|||..|
 Frog   246 PPQPLKSR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 91/264 (34%)
ca2NP_001015729.1 alpha_CA 1..259 CDD:381753 92/268 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.